DPCfam | MC164157
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 64 ± 6 aa |
| Residues in low-complexity regions (%) | 1.52 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.82 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF06398 |
| Sequences matching dominant architecture (%) | 18.6 |
| Average overlap percent | 51.25 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| D5GCU3 | 169-228 | 60 | EVDILYENQRGVFACGIPLFSSKGLLNLDPAPWQNGLFRDSAVSIVNAQLPDPSWAWAWK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2GQA7-F1 | 147-208 | 96.88 | 90.92 | View in AlphaFoldDB ↗ |