DPCfam | MC163520
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 124 ± 22 aa |
| Residues in low-complexity regions (%) | 5.73 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.26 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00581 |
| Sequences matching dominant architecture (%) | 41.35 |
| Average overlap percent | 54.17 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V6U0W0 | 425-520 | 96 | IVLTSSDGIVAALNVNDARKGISREVFYLSGGTDAWISAGHALETETRWLSRPIDVYKRPYEGTGNAREAMQGYLDWEYGLVGQL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9I0N4-F1 | 393-525 | 98.53 | 97.11 | View in AlphaFoldDB ↗ |