DPCfam | MC16342
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 288 ± 31 aa |
| Residues in low-complexity regions (%) | 28.17 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 67.21 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01585 |
| Sequences matching dominant architecture (%) | 88.68 |
| Average overlap percent | 15.48 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1B6KHJ7 | 2-230 | 229 | AVKAYYAPPGHDHPRDSDGWEKLGLYEYYRAKNTAKKRKEDDVIGGIRERSRTPSPISRPRSRSRTPPSKKRYRSRSRSKSRGRE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q8CGZ0-F1 | 646-919 | 99.28 | 61.37 | View in AlphaFoldDB ↗ |