DPCfam | MC163416
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 408 ± 98 aa |
| Residues in low-complexity regions (%) | 2.97 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.26 |
| Average transmembrane regions | 0.06 |
| Dominant Pfam architecture(s) | PF00075 |
| Sequences matching dominant architecture (%) | 78.87 |
| Average overlap percent | 33.52 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A015JU91 | 76-631 | 556 | ILGGNTPIRDYMSDLSAADIKSLKAKNIIYMDQIVSSDGNYLLSWSDVKRNNNNNYSGPIPAWYKNLTDNYVLSNNLRLIHPLND... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5HYU6-F1 | 2-144 | 28.40 | 96.30 | View in AlphaFoldDB ↗ |