DPCfam | MC163302
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 191 |
|---|---|
| Mean domain length (aa) | 214 ± 25 aa |
| Residues in low-complexity regions (%) | 2.8 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.02 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07179- PF14581 |
| Sequences matching dominant architecture (%) | 84.4 |
| Average overlap percent | 89.93 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V2NCG4 | 7-236 | 230 | TTLEALLIRAADTGQGIPDFLAALLDSTVLVPGWAEPAADGEGQMATFAPLTSADGSSVQPFYTSEARLAETQAAIPGYETRYLA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q32D42-F1 | 15-244 | 100.00 | 86.08 | View in AlphaFoldDB ↗ |