DPCfam | MC163299
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 131 |
|---|---|
| Mean domain length (aa) | 131 ± 10 aa |
| Residues in low-complexity regions (%) | 3.83 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 4.77 |
| Average transmembrane regions | 2.02 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0CUE0 | 418-547 | 130 | ISGKDVVASFKVLASIIIVPISVFIYTVLFYLWLTVYKIVDEELTFRYTIIFLLMWPIYITAMIRSNDGLIRHARKVNSQILFYL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-C1GW00-F1 | 462-596 | 99.25 | 84.59 | View in AlphaFoldDB ↗ |