DPCfam | MC163290
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 270 ± 24 aa |
| Residues in low-complexity regions (%) | 6.28 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.54 |
| Average transmembrane regions | 0.9 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A099P484 | 3-283 | 281 | NTIPALFASYSLVPGLKKSLPHSEQMPFSEHEANVYLTRALEQCNNDHYIFVKVPGLRVTDFQNFSAWTNLRNRLVKASTIFAMP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A1C1CDF9-F1 | 11-296 | 98.59 | 76.70 | View in AlphaFoldDB ↗ |