DPCfam | MC163014
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 171 |
|---|---|
| Mean domain length (aa) | 624 ± 42 aa |
| Residues in low-complexity regions (%) | 4.29 |
| Residues in coiled-coil regions (%) | 3.21 |
| Predicted disordered residues (%) | 45.51 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00823 |
| Sequences matching dominant architecture (%) | 0.81 |
| Average overlap percent | 13.85 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A389599 | 3-632 | 630 | VSYDDIVNAELGSLEDAAKSWSSMGTRFGTLQDNYSDHVRAAADSDTWSGYAAAGYKNWGQTTTETYGQAKAEAQGVAALLRLAH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0EUM3-F1 | 34-175 | 23.90 | 95.31 | View in AlphaFoldDB ↗ |