DPCfam | MC162914
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 201 ± 21 aa |
| Residues in low-complexity regions (%) | 4.82 |
| Residues in coiled-coil regions (%) | 0.38 |
| Predicted disordered residues (%) | 14.91 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF14222 |
| Sequences matching dominant architecture (%) | 96.63 |
| Average overlap percent | 17.92 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1U8CL83 | 504-670 | 167 | RLTVHMDEELRALAFNTLQALMLDFPDWREDVLSGFVYFIVREVTDVHPTLLDNAVKMLVQLINQWKQAAQMYNKTQDSQHGIAN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A044V8Y5-F1 | 572-779 | 99.51 | 78.16 | View in AlphaFoldDB ↗ |