DPCfam | MC162871
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 101 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Residues in low-complexity regions (%) | 2.83 |
| Residues in coiled-coil regions (%) | 7.14 |
| Predicted disordered residues (%) | 8.07 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF10266 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 21.85 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q54IR8 | 7-119 | 113 | GEGSQAGQNLLRLVSRGNAIIAELLRLSAHIPSVFKLEDRNEARKYQDILLDFKYLSNPDFYESKIEENADLVDLETEFRDNHID... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q6DIP9-F1 | 9-123 | 100.00 | 89.98 | View in AlphaFoldDB ↗ |