DPCfam | MC16240
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 91 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Residues in low-complexity regions (%) | 5.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.68 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K7X169 | 1-71 | 71 | MLAQFQNLYPNGSIISELIEIFQGKYIVRVSIQLEGITRATAIAGAETVEAAEDQARNRALTVLGVKNTPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P42350-F1 | 6-74 | 98.57 | 92.27 | View in AlphaFoldDB ↗ |