DPCfam | MC162261
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 89 ± 18 aa |
| Residues in low-complexity regions (%) | 9.7 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 39.28 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01391 |
| Sequences matching dominant architecture (%) | 22.58 |
| Average overlap percent | 18.42 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1N7BPV1 | 30-107 | 78 | VDGYQIVTLPNANVPNFTRRTVYCPAGKRAVGGGGEAQGNDAVLVGSFPTPDGTGWIALGRQNSYNTVGISVYAICAK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P09748-F1 | 381-443 | 68.09 | 93.28 | View in AlphaFoldDB ↗ |