DPCfam | MC16203
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 511 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Residues in low-complexity regions (%) | 4.23 |
| Residues in coiled-coil regions (%) | 1.67 |
| Predicted disordered residues (%) | 1.64 |
| Average transmembrane regions | 2.28 |
| Dominant Pfam architecture(s) | PF01794 |
| Sequences matching dominant architecture (%) | 89.74 |
| Average overlap percent | 31.14 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C5FZP3 | 67-174 | 108 | DGWRRLFVTIFALVHVLLFVVGILNYSLKDNLSNARGLLGSSYPIARAAALVLHFDVAVILFHKSIPFHQITAWSIVFFSLLHTI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0K0DSC4-F1 | 1047-1160 | 99.13 | 87.21 | View in AlphaFoldDB ↗ |