DPCfam | MC16177
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 181 |
|---|---|
| Mean domain length (aa) | 868 ± 137 aa |
| Residues in low-complexity regions (%) | 3.19 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 26.39 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00109- PF02801 |
| Sequences matching dominant architecture (%) | 69.51 |
| Average overlap percent | 37.67 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000839B832 | 567-1158 | 592 | FAGEVALVTGAAPGSIATALVERLLEGGATVIMTASRVSQARKEFARKLYAAHGAAGSALWLVPANLSSYRDIDALIEWIGNEQR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P78615-F1 | 625-1577 | 100.00 | 93.65 | View in AlphaFoldDB ↗ |