DPCfam | MC161741
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 438 ± 53 aa |
| Residues in low-complexity regions (%) | 13.63 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 81.01 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF04886 |
| Sequences matching dominant architecture (%) | 1.45 |
| Average overlap percent | 6.76 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| N1JFA9 | 73-500 | 427 | SENELLSSPRLSVLNTKDGNISDTGSATDSLLDLYGLNRGGISSMESGDGLSSNSSKIKPNEDSEKSRWIHRDKLARIESQELQA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VNE0-F1 | 112-527 | 98.42 | 55.85 | View in AlphaFoldDB ↗ |