DPCfam | MC161529
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 161 |
|---|---|
| Mean domain length (aa) | 86 ± 10 aa |
| Residues in low-complexity regions (%) | 12.75 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 5.76 |
| Average transmembrane regions | 1.88 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004E59AA4 | 2-83 | 82 | AFGAKEIIVYIRRTSYIFVCDHPFIIGMVFFVLILYSFFPSLFVFLVSSSPVIVCTAILLGTILIYGEPNIPEVEKEDRKTQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0R0KD34-F1 | 3-88 | 93.48 | 73.81 | View in AlphaFoldDB ↗ |