DPCfam | MC161512
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 711 |
|---|---|
| Mean domain length (aa) | 152 ± 24 aa |
| Residues in low-complexity regions (%) | 3.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.28 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | PF02847 |
| Sequences matching dominant architecture (%) | 91.76 |
| Average overlap percent | 69.49 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7RX84 | 506-643 | 138 | VNLRRTIYLSIQSSADPEEAAHKLMKLRLPAGQEAELVSMIVESCAQEKVYLKFMGLLGERFARLNRMWMDLFEESFAKYYSTIH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5C9Z4-F1 | 644-791 | 98.68 | 89.67 | View in AlphaFoldDB ↗ |