DPCfam | MC161158
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 671 |
|---|---|
| Mean domain length (aa) | 461 ± 50 aa |
| Residues in low-complexity regions (%) | 1.57 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 19.5 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13320 |
| Sequences matching dominant architecture (%) | 70.23 |
| Average overlap percent | 15.08 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1V6CQR1 | 63-564 | 502 | SAANETVSFQLVVDAGQTPVESLRVECSDLAATNTKIPAANVRFFKALGIEVTDYPPWYLRLVDAVPGPARFYDPLVPSDAPAGG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q7Y231-F1 | 264-612 | 72.97 | 96.46 | View in AlphaFoldDB ↗ |