DPCfam | MC160962
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 209 ± 35 aa |
| Residues in low-complexity regions (%) | 18.87 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 52.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00249 |
| Sequences matching dominant architecture (%) | 45.65 |
| Average overlap percent | 9.79 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0008A0D361 | 1-192 | 192 | MDIFPSQPDLSLRISPPNTKPISDWRKQDGDTELGFMTSESNMNTPLTFESPSEGRSATDSTTTGQNTLLLHPQPRHYHHHDPLH... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A368UIK4-F1 | 1-219 | 99.51 | 57.07 | View in AlphaFoldDB ↗ |