DPCfam | MC160768
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Residues in low-complexity regions (%) | 3.16 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 24.08 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| W1Q0V7 | 828-937 | 110 | IDKDSSRMHIFCLEHAMEAEKQLQLMGGANILLLCHSDYPKIEEKAKSIAEEMGVIHSWNGIVFKEASLEDLERLRVVLEEEDDE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q2QTX9-F1 | 788-894 | 99.07 | 83.12 | View in AlphaFoldDB ↗ |