DPCfam | MC160598
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Residues in low-complexity regions (%) | 0.6 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 33.13 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09469 |
| Sequences matching dominant architecture (%) | 37.5 |
| Average overlap percent | 84.17 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00094EFB69 | 144-230 | 87 | PKYSAPGHQPFESTFRLKVHLPRNQLYVTRVSRNVLLEDIMKKVCGEKNLDPTKYDFKHPGNLDQILDPKFTLSDYQITEIYVVA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-X2JI50-F1 | 75-152 | 96.30 | 92.18 | View in AlphaFoldDB ↗ |