DPCfam | MC160585
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 261 |
|---|---|
| Mean domain length (aa) | 140 ± 14 aa |
| Residues in low-complexity regions (%) | 4.23 |
| Residues in coiled-coil regions (%) | 0.19 |
| Predicted disordered residues (%) | 30.61 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF09299 |
| Sequences matching dominant architecture (%) | 97.04 |
| Average overlap percent | 42.34 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| C7R625 | 447-589 | 143 | ERLRMDFLPVYERSVQRYGIEIDGLFYYHPLLAKWIKQKNPHSIDTHGKYIVKRDPRDISRVYFYDPDLNDYLEIPCRNRGMVSM... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P18416-F1 | 362-475 | 86.13 | 66.66 | View in AlphaFoldDB ↗ |