DPCfam | MC160346
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 3451 |
|---|---|
| Mean domain length (aa) | 67 ± 9 aa |
| Residues in low-complexity regions (%) | 2.59 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.79 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00588 |
| Sequences matching dominant architecture (%) | 98.77 |
| Average overlap percent | 46.72 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000A19C8E0 | 88-167 | 80 | LDRVEQSPDALLVLLDGVEDPHNLGAILRSAEAFGAMAVAQPKDRSAPLSPVAVKASAGAAERMDLVKMTNLARAIEELQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9JUU8-F1 | 96-167 | 97.14 | 93.72 | View in AlphaFoldDB ↗ |