DPCfam | MC15999
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 241 |
|---|---|
| Mean domain length (aa) | 135 ± 34 aa |
| Residues in low-complexity regions (%) | 7.54 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 59.21 |
| Average transmembrane regions | 0.05 |
| Dominant Pfam architecture(s) | PF10248 |
| Sequences matching dominant architecture (%) | 93.62 |
| Average overlap percent | 78.75 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A9YQB6 | 62-257 | 196 | DPFDMHRDFERQFEDVMRNIMGIMGSGSHGMPALPEVPFRDAPAQPPQEYLKPSDDHPRNRYLKPSFEKSKPPTSRADSDLDGRI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3ZPN3-F1 | 59-201 | 96.60 | 79.64 | View in AlphaFoldDB ↗ |