DPCfam | MC15968
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 76 ± 14 aa |
| Residues in low-complexity regions (%) | 4.0 |
| Residues in coiled-coil regions (%) | 0.5 |
| Predicted disordered residues (%) | 27.2 |
| Average transmembrane regions | 0.09 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0Q9TLL5 | 36-99 | 64 | GYQAHEAELNDGGIWVVNSKDGLFGRINKPINQLDSVVFADRSDLPLDIVQDGAAVLAVDERAS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A9VQJ9-F1 | 24-43 | 23.26 | 96.28 | View in AlphaFoldDB ↗ |