DPCfam | MC158809
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 1571 |
|---|---|
| Mean domain length (aa) | 176 ± 27 aa |
| Residues in low-complexity regions (%) | 1.87 |
| Residues in coiled-coil regions (%) | 0.02 |
| Predicted disordered residues (%) | 13.8 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF13338 |
| Sequences matching dominant architecture (%) | 22.22 |
| Average overlap percent | 21.52 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G1IRL6 | 19-175 | 157 | EDVFKWFPKAHRKSTLNQLNLWIKKGYLERISKGAYRLAEAEISDPFILASFLYGPSYISLESALNAYGIIPDIPFSTTSVALPK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A132P297-F1 | 18-188 | 94.83 | 95.90 | View in AlphaFoldDB ↗ |