DPCfam | MC158696
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 182 ± 49 aa |
| Residues in low-complexity regions (%) | 0.44 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 12.69 |
| Average transmembrane regions | 0.23 |
| Dominant Pfam architecture(s) | PF00680 |
| Sequences matching dominant architecture (%) | 90.14 |
| Average overlap percent | 38.81 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A143VPI0 | 1105-1357 | 252 | PVQLFRHIKNFRFSMLAPEYQTQQMRQMYNWYVENILRRYVCMPSGEITMQHKGNPSGQVSTTMDNNMVNVFLQAFEYAYMWPNK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P03876-F1 | 549-614 | 40.38 | 89.26 | View in AlphaFoldDB ↗ |