DPCfam | MC158647
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 251 |
|---|---|
| Mean domain length (aa) | 83 ± 11 aa |
| Residues in low-complexity regions (%) | 1.26 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.74 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02772- PF02773 |
| Sequences matching dominant architecture (%) | 88.65 |
| Average overlap percent | 36.22 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F4IQN2 | 34-114 | 80 | VTIEYDGNRAVRLDTVVVSTQHAADIDLDGLLTPDVRDHVVEYVLAQLAEDGIKLETEGYRLLVNPTGRFEIGGPMGDAG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q5KW02-F1 | 188-267 | 98.77 | 97.25 | View in AlphaFoldDB ↗ |