DPCfam | MC158137
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 151 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Residues in low-complexity regions (%) | 0.47 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 14.73 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0006EAE0CD | 1402-1463 | 62 | IVPADNLLQSEETTDLKVFTRPGVLGYFKRQFLLEIGHLPVIPIKVFGWGVIPQIYLTIPRP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-E9QEP3-F1 | 741-804 | 94.03 | 83.93 | View in AlphaFoldDB ↗ |