DPCfam | MC157980
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 379 ± 14 aa |
| Residues in low-complexity regions (%) | 3.78 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 27.03 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13116 |
| Sequences matching dominant architecture (%) | 74.47 |
| Average overlap percent | 24.63 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A076K078 | 182-565 | 384 | LTEARLDQLTVNYTDRVTKRAWTLDGGRLSARRANRLMTLRGDLALLAGGGELATLGLFYNATGPGAGTLGAEFDNLPAQDLAVQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3H0M4-F1 | 233-340 | 29.55 | 79.99 | View in AlphaFoldDB ↗ |