DPCfam | MC157896
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 147 ± 12 aa |
| Residues in low-complexity regions (%) | 3.22 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 8.86 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF04471 |
| Sequences matching dominant architecture (%) | 44.07 |
| Average overlap percent | 48.41 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0F7FIC7 | 59-205 | 147 | PLNSLLLRAWLAGYDVVTLALNSGWSTFEEVVAQALREAGFNAYRALRFKHQGKRYEVDILAVKSRLALCVDCKRWERLRESMLL... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-O27954-F1 | 2-121 | 85.62 | 93.87 | View in AlphaFoldDB ↗ |