DPCfam | MC157728
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 851 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Residues in low-complexity regions (%) | 0.51 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 16.15 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF04383 |
| Sequences matching dominant architecture (%) | 25.9 |
| Average overlap percent | 66.68 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A165IX51 | 21-104 | 84 | TKGVALMRRRADGWLNATQILKVAGFDKPQRTRILERDVQKGEHEKVQGGYGKYQGTWVPLDRGLEIAQEYHIEDFIRPIVNFK... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VZG8-F1 | 4-110 | 97.20 | 88.34 | View in AlphaFoldDB ↗ |