DPCfam | MC157679
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 151 ± 15 aa |
| Residues in low-complexity regions (%) | 0.92 |
| Residues in coiled-coil regions (%) | 0.05 |
| Predicted disordered residues (%) | 6.56 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07227 |
| Sequences matching dominant architecture (%) | 99.37 |
| Average overlap percent | 77.62 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| K4A4V0 | 1039-1179 | 141 | CCNLSCQSILPVDDCDCKVCQRKTGFCSSCMCIVCSKFDSASNTCSWVGCDVCLHWCHTDCGLRHSLIRKGQSASRAYGTTEMQF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-I1LFU2-F1 | 169-328 | 97.52 | 85.87 | View in AlphaFoldDB ↗ |