DPCfam | MC157676
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 341 |
|---|---|
| Mean domain length (aa) | 71 ± 8 aa |
| Residues in low-complexity regions (%) | 5.6 |
| Residues in coiled-coil regions (%) | 0.08 |
| Predicted disordered residues (%) | 19.4 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | PF03313 |
| Sequences matching dominant architecture (%) | 98.32 |
| Average overlap percent | 30.99 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| R7PPT3 | 1-66 | 66 | MEVPCVKRNGFEAVHTLVAVEMAMAGIQSQIPVDEVIQAMDEIGKLMPASIRETSLAGLAMTETGQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9HTI5-F1 | 381-454 | 98.65 | 95.01 | View in AlphaFoldDB ↗ |