DPCfam | MC157575
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 209 ± 22 aa |
| Residues in low-complexity regions (%) | 3.94 |
| Residues in coiled-coil regions (%) | 3.76 |
| Predicted disordered residues (%) | 13.33 |
| Average transmembrane regions | 0.02 |
| Dominant Pfam architecture(s) | PF18151 |
| Sequences matching dominant architecture (%) | 64.04 |
| Average overlap percent | 29.42 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0P5RJI7 | 1131-1342 | 212 | HVMNNATAASNSTEHELIIFLKLQLAEAINLQDRSLVAQLHETLRCVRLFDADGCSKLFHSLKEDYKGRAPYLSYLIQCRQSLLS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A5D794-F1 | 1086-1280 | 97.50 | 89.62 | View in AlphaFoldDB ↗ |