DPCfam | MC157401
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 94 ± 16 aa |
| Residues in low-complexity regions (%) | 1.31 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 35.61 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00134 |
| Sequences matching dominant architecture (%) | 3.92 |
| Average overlap percent | 1.24 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1I7S7J0 | 63-159 | 97 | HIIDRELPDDDEFDPSTHPTAPPTFIERSQSGINIKTNRYSSYFLDQINERRTGLKRWNSCSTIYLDDSTISQPHLKNTVLCMSF... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P34624-F1 | 53-162 | 99.04 | 74.72 | View in AlphaFoldDB ↗ |