DPCfam | MC157393
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 81 |
|---|---|
| Mean domain length (aa) | 91 ± 9 aa |
| Residues in low-complexity regions (%) | 2.08 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 29.31 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF08798 |
| Sequences matching dominant architecture (%) | 100.0 |
| Average overlap percent | 42.24 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1D2IKW8 | 1-82 | 82 | MPFLSRIRINPLRAESRKLLASPRAMHAAVQGGIPGLPAEERTLWRLDADNPHRPQLFVLTTDKPDWTHLVEQAGWPAADGE... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q53WG9-F1 | 1-76 | 78.95 | 95.81 | View in AlphaFoldDB ↗ |