DPCfam | MC15714
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 121 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Residues in low-complexity regions (%) | 2.04 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 25.23 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF07366 |
| Sequences matching dominant architecture (%) | 10.81 |
| Average overlap percent | 18.55 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI000982A72B | 300-391 | 92 | GIPPTGKRLEIPFTAVVNIRGDRLYHEHIAWDQSTALRQLGLLPDYLPYPYALPDGRTPGPGKRFEYKVPAAGRDTAEKMRDKNS... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0D2DL95-F1 | 306-394 | 98.78 | 96.97 | View in AlphaFoldDB ↗ |