DPCfam | MC15711
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 231 |
|---|---|
| Mean domain length (aa) | 182 ± 28 aa |
| Residues in low-complexity regions (%) | 8.37 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 28.6 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF00501 |
| Sequences matching dominant architecture (%) | 10.11 |
| Average overlap percent | 50.25 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI00037CB051 | 9-170 | 162 | ALTDPAKPLLTWYSPTERTELSGATLGNWVAKMSNLLVNECGLGPGDVAEIDLPPHWQTAVILLASWNVGLTVGESGDVSFGLPG... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-K0F6J7-F1 | 24-193 | 97.84 | 97.40 | View in AlphaFoldDB ↗ |