DPCfam | MC157103
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 721 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Residues in low-complexity regions (%) | 3.62 |
| Residues in coiled-coil regions (%) | 0.2 |
| Predicted disordered residues (%) | 17.28 |
| Average transmembrane regions | 0.01 |
| Dominant Pfam architecture(s) | PF02092 |
| Sequences matching dominant architecture (%) | 99.21 |
| Average overlap percent | 25.36 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0S8K9U4 | 389-504 | 116 | RAALLCKADLVTHMVGEKEFSKLQGYMGQQYALASSESEAVAQAIFEHYLPRFAEDLLPQSLPGSVVAIADKVDTIVGCFGVGLI... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0C4C9-F1 | 383-498 | 98.31 | 94.99 | View in AlphaFoldDB ↗ |