DPCfam | MC157081
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 517 ± 86 aa |
| Residues in low-complexity regions (%) | 2.13 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 20.62 |
| Average transmembrane regions | 0.04 |
| Dominant Pfam architecture(s) | PF00646 |
| Sequences matching dominant architecture (%) | 25.0 |
| Average overlap percent | 8.16 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| UPI0004623D86 | 24-327 | 304 | LDCLTNDILLDSVMSYLDVLDILRLRQVSKLYYELTHHAALWKRILRTTDIPLPPVPPTARHTADRMTGLEAERLVVRSLSLHMN... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-D3Z8N7-F1 | 22-64 | 8.16 | 85.47 | View in AlphaFoldDB ↗ |