DPCfam | MC156928
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 188 ± 27 aa |
| Residues in low-complexity regions (%) | 7.4 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 34.61 |
| Average transmembrane regions | 0.77 |
| Dominant Pfam architecture(s) | PF02743 |
| Sequences matching dominant architecture (%) | 4.44 |
| Average overlap percent | 55.41 |
| Pfam Overlap Label | Shifted |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E7QSP4 | 20-191 | 172 | VPSRIRRSYAAKFGAVLFAILVLIAAIGFFIHLDTKQLVTGQTNDELQSAAKMEAESLHEWVGQKRSTTRYLSSSLDGNESNAER... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-B0R474-F1 | 6-206 | 98.53 | 86.80 | View in AlphaFoldDB ↗ |