DPCfam | MC15672
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 211 |
|---|---|
| Mean domain length (aa) | 759 ± 118 aa |
| Residues in low-complexity regions (%) | 2.95 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 23.77 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF16073- PF08354 |
| Sequences matching dominant architecture (%) | 69.59 |
| Average overlap percent | 87.13 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A024G5L5 | 164-999 | 836 | IGHSQGIVSALVCALARDDMELYTIASQYVRYMFWHGLRVQETWTTLVPETLKDATPMLAVSGLTEEEVEHVLYSFNKKSGSKTQ... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-P34731-F1 | 258-1077 | 99.76 | 92.26 | View in AlphaFoldDB ↗ |