DPCfam | MC156670
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 111 |
|---|---|
| Mean domain length (aa) | 173 ± 32 aa |
| Residues in low-complexity regions (%) | 7.71 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 6.37 |
| Average transmembrane regions | 3.27 |
| Dominant Pfam architecture(s) | PF07916 |
| Sequences matching dominant architecture (%) | 98.59 |
| Average overlap percent | 47.37 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0A0CSB0 | 251-369 | 119 | AVILMAVTIILPLIIVFAVYEYKTVITLTFVMFALNFLTFWWELARWLDSWLLEALYGSDTHSRWNMAGFQNSTDDIIMSFVMGT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0H3GT80-F1 | 317-493 | 90.96 | 65.30 | View in AlphaFoldDB ↗ |