DPCfam | MC156598
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 312 ± 23 aa |
| Residues in low-complexity regions (%) | 6.24 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 10.59 |
| Average transmembrane regions | 1.98 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| Q7MSB4 | 75-389 | 315 | YQREIVHATYRLLVLANLQSLKTDFLGGDGSVGVLNPNSPWKKEADGSFSNTFYFKIQAQSFTIPKIRVSAEVNGYTDSDESEGR... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q0PB00-F1 | 82-395 | 99.68 | 90.31 | View in AlphaFoldDB ↗ |