DPCfam | MC156251
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 51 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Residues in low-complexity regions (%) | 2.6 |
| Residues in coiled-coil regions (%) | 0.94 |
| Predicted disordered residues (%) | 14.19 |
| Average transmembrane regions | 0.03 |
| Dominant Pfam architecture(s) | UNKNOWN |
| Sequences matching dominant architecture (%) | 0.0 |
| Average overlap percent | 0.0 |
| Pfam Overlap Label | NONE |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| E1BVC2 | 735-853 | 119 | VLAEIFQLVHSPLLQGGALNAIIDFFQALVLTKAATVGYSELMKQLTAPVYSSGPSGASAALHKQAYYSAAKCVAALSSACPKEA... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A7MBJ5-F1 | 747-848 | 99.04 | 87.13 | View in AlphaFoldDB ↗ |