DPCfam | MC155756
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Residues in low-complexity regions (%) | 1.23 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 7.38 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF02351 |
| Sequences matching dominant architecture (%) | 59.52 |
| Average overlap percent | 70.87 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A1W4UXM4 | 522-596 | 75 | LSTEIIKQHFQSTCHTALDTCREDPSCSSSLQPMLTHCELHRCNRNACMSSLQAFYKGPHEDLNLDIAFCLCKKT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A0B4K7J4-F1 | 629-700 | 97.30 | 82.76 | View in AlphaFoldDB ↗ |