DPCfam | MC155424
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 201 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Residues in low-complexity regions (%) | 0.66 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 17.87 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF01734 |
| Sequences matching dominant architecture (%) | 89.8 |
| Average overlap percent | 32.69 |
| Pfam Overlap Label | Reduced |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0C3KR58 | 121-192 | 72 | MLGRLRMSIQECIECYTELSKDVFYGDWELWSSANWNVLSGHKFSGEKLENAVKTVVEKYRGATGTHMHDDP... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175VWP7-F1 | 59-117 | 94.03 | 74.64 | View in AlphaFoldDB ↗ |