DPCfam | MC155337
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 71 |
|---|---|
| Mean domain length (aa) | 590 ± 51 aa |
| Residues in low-complexity regions (%) | 12.87 |
| Residues in coiled-coil regions (%) | 7.85 |
| Predicted disordered residues (%) | 65.45 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF13758- PF12927 |
| Sequences matching dominant architecture (%) | 73.91 |
| Average overlap percent | 96.47 |
| Pfam Overlap Label | Equivalent |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| A0A0G2E4P5 | 9-557 | 549 | VEKQRLELQDQVTKLRKALRHWQTWEIEYEGLKEEILLRPATSSSKDLLDAAKDFKAELVDDDEINSLLGLNTGRPPRSQQQIAD... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-A0A175W3L8-F1 | 8-590 | 99.83 | 67.65 | View in AlphaFoldDB ↗ |