DPCfam | MC155335
Metacluster Properties and Pfam Annotations
| Number of UniRef50 seed sequences | 61 |
|---|---|
| Mean domain length (aa) | 164 ± 16 aa |
| Residues in low-complexity regions (%) | 1.02 |
| Residues in coiled-coil regions (%) | 0.0 |
| Predicted disordered residues (%) | 19.62 |
| Average transmembrane regions | 0 |
| Dominant Pfam architecture(s) | PF00340 |
| Sequences matching dominant architecture (%) | 84.85 |
| Average overlap percent | 62.02 |
| Pfam Overlap Label | Extended |
Seed Sequences
| Protein ID | Range | Length | Seed Sequence |
|---|---|---|---|
| I3KDY4 | 6-178 | 173 | CINVEFLDTAEDSFYFGVVQQDLKEDDFTQPKDHHWSIESTNGFGYLILNQEDTFVLQTCCEKKLCIRTYRSSFVNEKLPVMIYT... |
Representative AlphaFold Structure
| AlphaFold ID | Sequence Range | HMM Coverage | Avg pLDDT | AlphaFold 3D Structure |
|---|---|---|---|---|
| AF-Q9TU73-F1 | 23-188 | 100.00 | 91.24 | View in AlphaFoldDB ↗ |